PDX1 (Pancreas/Duodenum Homeobox Protein 1, PDX-1, Glucose-sensitive Factor, GSF, Insulin Promoter Factor 1, IPF-1, Insulin Upstream Factor 1, IUF-1, Islet/Duodenum Homeobox-1, IDX-1, Somatostatin-transactivating Factor 1, STF-1, IPF1, STF1) (FITC)
Cat# 131114-FITC-100ul
Size : 100ul
Brand : US Biological
Contact local distributor :
Phone : +1 850 650 7790
131114-FITC PDX1 (Pancreas/Duodenum Homeobox Protein 1, PDX-1, Glucose-sensitive Factor, GSF, Insulin Promoter Factor 1, IPF-1, Insulin Upstream Factor 1, IUF-1, Islet/Duodenum Homeobox-1, IDX-1, Somatostatin-transactivating Factor 1, STF-1, IPF1, STF1) (FITC)
Clone Type
PolyclonalHost
rabbitSource
humanIsotype
IgGGrade
Affinity PurifiedApplications
WBCrossreactivity
Hu MoAccession #
BC111592, AAI11593.1Shipping Temp
Blue IceStorage Temp
-20°CPDX1, also known as Pancreas/duodenum homeobox protein 1, is a nuclear protein belonging to the Antp homeobox family and IPF1/XlHbox-8 subfamily with a homeobox DNA-binding domain. It activates insulin, somatostatin, glucokinase, islet amyloid polypeptide and glucose transporter type 2 gene transcription and is particularly involved in glucose-dependent regulation of insulin gene transcription. During development, PDX1 specifies the early pancreatic epithelium, permitting its proliferation, branching and subsequent differentiation. Expression is common in duodenum and pancreas (Langerhans islet beta cells and small subsets of endocrine non-beta-cells, at low levels in acinar cells). Defects in PDX1 are associated with pancreatic agenesis, maturity onset diabetes noninsulin-dependent diabetes mellitus (NIDDM), also known as diabetes mellitus type II, and maturity onset diabetes of the young type 4 (MODY4).
Applications:
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution:
Optimal dilutions to be determined by the researcher.
AA Sequence:
MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQGSPPDISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPPPPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQEPR
Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.