PEG3 Antibody - C-terminal region - Biotin
Cat# ARP38756_P050-Biotin
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
PEG3 Antibody - C-terminal region : Biotin (ARP38756_P050-Biotin)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-PEG3 (ARP38756_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PEG3 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: FGECSGYIERASTSTGGANQADEKYFKCDVCGQLFNDRLSLARHQNTHTG |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-PEG3 (ARP38756_P050-Biotin) antibody is Catalog # AAP38756 (Previous Catalog # AAPP20962) |
| Sample Type Confirmation | PEG3 is strongly supported by BioGPS gene expression data to be expressed in A204 |
| Reference | Dowdy,S.C., et al., (2005) Gynecol. Oncol. 99 (1), 126-134 |
|---|---|
| Gene Symbol | PEG3 |
| Gene Full Name | Paternally expressed 3 |
| Alias Symbols | PW1, ZNF904, ZSCAN24, ZKSCAN22 |
| NCBI Gene Id | 5178 |
| Protein Name | Paternally-expressed gene 3 protein |
| Description of Target | PEG3 induces apoptosis in cooperation with SIAH1A and acts as a mediator between TP53/p53 and BAX in a neuronal death pathway that is activated by DNA damage. PEG3 acts synergistically with TRAF2 and inhibits TNF induced apoptosis through activation of NF-kappa-B. PEG3 also possesses a tumor suppressing activity in glioma cells. |
| Uniprot ID | Q9GZU2 |
| Protein Accession # | NP_006201 |
| Nucleotide Accession # | NM_006210 |
| Protein Size (# AA) | 1588 |
| Molecular Weight | 181kDa |
| Protein Interactions | PEG3; ALB; USP7; TRAF2; SIAH2; SIAH1; BRCA1; |
