PGBD1 Antibody - N-terminal region - FITC
Cat# ARP36073_P050-FITC
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
PGBD1 Antibody - N-terminal region : FITC (ARP36073_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-PGBD1 (ARP36073_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Cow, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PGBD1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 92%; Human: 100%; Rabbit: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: YEALPGPAPENEDGLVKVKEEDPTWEQVCNSQEGSSHTQEICRLRFRHFC |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-PGBD1 (ARP36073_P050-FITC) antibody is Catalog # AAP36073 (Previous Catalog # AAPP07383) |
| Reference | Suzuki,Y., Gene 200 (1-2), 149-156 (1997) |
|---|---|
| Gene Symbol | PGBD1 |
| Gene Full Name | PiggyBac transposable element derived 1 |
| Alias Symbols | SCAND4, HUCEP-4, dJ874C20.4 |
| NCBI Gene Id | 84547 |
| Protein Name | PiggyBac transposable element-derived protein 1 |
| Description of Target | PGBD1 belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known. The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known. |
| Uniprot ID | Q96JS3 |
| Protein Accession # | NP_115896 |
| Nucleotide Accession # | NM_032507 |
| Protein Size (# AA) | 809 |
| Molecular Weight | 92kDa |
| Protein Interactions | ZSCAN22; PGBD1; ZNF446; SCAND1; ZNF24; TRAF2; MEOX2; NR4A1; |
