PLP1 antibody - N-terminal region
Cat# ARP33843_P050
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
PLP1 Antibody - N-terminal region (ARP33843_P050)
| Datasheets/Manuals | Printable datasheet for anti-PLP1 (ARP33843_P050) antibody |
|---|
| Tested Species Reactivity | Human, Mouse |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PLP1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 75% |
| Peptide Sequence | Synthetic peptide located within the following region: GHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGAL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-PLP1 (ARP33843_P050) antibody is Catalog # AAP33843 (Previous Catalog # AAPP04914) |
| Reference | Regis,S., (2008) Clin. Genet. 73 (3), 279-287 |
|---|---|
| Gene Symbol | PLP1 |
| Gene Full Name | Proteolipid protein 1 |
| Alias Symbols | PLP, PMD, HLD1, MMPL, SPG2, GPM6C, PLP/DM20 |
| NCBI Gene Id | 5354 |
| Protein Name | Myelin proteolipid protein |
| Description of Target | PLP1 is a transmembrane proteolipid protein that is the predominant myelin protein present in the central nervous system. It may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause X-linked Pelizaeus-Merzbacher disease and spastic paraplegia type 2. Alternatively spliced transcript variants encoding distinct isoforms or having different 5' UTRs, have been identified for this gene.This gene encodes a transmembrane proteolipid protein that is the predominant myelin protein present in the central nervous system. It may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause X-linked Pelizaeus-Merzbacher disease and spastic paraplegia type 2. Alternatively spliced transcript variants encoding distinct isoforms or having different 5' UTRs, have been identified for this gene. |
| Uniprot ID | P60201 |
| Protein Accession # | NP_000524 |
| Nucleotide Accession # | NM_000533 |
| Protein Size (# AA) | 277 |
| Molecular Weight | 30kDa |
| Protein Interactions | PTPRN; CLN8; Htt; ITGAV; ITGA5; MAG; MBP; CANX; CALR; |
