POP4 Antibody - C-terminal region - FITC
Cat# ARP40674_T100-FITC
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
POP4 Antibody - C-terminal region : FITC (ARP40674_T100-FITC)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-POP4 (ARP40674_T100-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | IHC, WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human POP4 |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Yeast: 91%; Zebrafish: 92% |
| Peptide Sequence | Synthetic peptide located within the following region: EDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-POP4 (ARP40674_T100-FITC) antibody is Catalog # AAP40674 (Previous Catalog # AAPY00926) |
| Subunit | p29 |
| Reference | Welting,T.J., (2004) (er) Nucleic Acids Res. 32 (7), 2138-2146 |
|---|---|
| Gene Symbol | POP4 |
| Gene Full Name | Processing of precursor 4, ribonuclease P/MRP subunit (S. cerevisiae) |
| Alias Symbols | RPP29 |
| NCBI Gene Id | 10775 |
| Protein Name | Ribonuclease P protein subunit p29 |
| Description of Target | POP4 is a part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. It may function with RPP38 to coordinate the nucleolar targeting and/or assembly of RNase P. |
| Uniprot ID | O95707 |
| Protein Accession # | NP_006618 |
| Nucleotide Accession # | NM_006627 |
| Protein Size (# AA) | 220 |
| Molecular Weight | 24kDa |
| Protein Interactions | UBC; POP1; RPP14; RPP25; POP5; RPP38; RPP30; POP4; RMRP; RPPH1; |
