PRKDC (Protein Kinase, DNA-Activated, Catalytic Polypeptide, DNA-PKcs, DNAPK, DNPK1, HYRC, HYRC1, XRCC7, p350) (FITC)
Cat# 250494-FITC-100ul
Size : 100ul
Brand : US Biological
250494-FITC PRKDC (Protein Kinase, DNA-Activated, Catalytic Polypeptide, DNA-PKcs, DNAPK, DNPK1, HYRC, HYRC1, XRCC7, p350) (FITC)






Clone Type
MonoclonalHost
mouseIsotype
IgG2a,kGrade
PurifiedApplications
E IF IHC WBAccession #
NP_008835Shipping Temp
Blue IceStorage Temp
-20°CThe PRKDC gene encodes the catalytic subunit of a nuclear DNA-dependent serine/threonine protein kinase (DNA-PK). The second component is the autoimmune antigen Ku (MIM 152690), which is encoded by the G22P1 gene on chromosome 22q. On its own, the catalytic subunit of DNA-PK is inactive and relies on the G22P1 component to direct it to the DNA and trigger its kinase activity; PRKDC must be bound to DNA to express its catalytic properties.[supplied by OMIM
Applications:
Suitable for use in Immunofluorescence, Western Blot, Immunohistochemistry. Other applications not tested.
Recommended Dilution:
Optimal dilutions to be determined by the researcher.
AA Sequence:
KMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGREPWM
Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.
Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.

