PTDSS1 antibody - N-terminal region
Cat# ARP47068_P050
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
PTDSS1 Antibody - N-terminal region (ARP47068_P050)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-PTDSS1 (ARP47068_P050) antibody |
|---|
| Publications | A comprehensive phenotypic CRISPR-Cas9 screen of the ubiquitin pathway uncovers roles of ubiquitin ligases in mitosis Deficient Endoplasmic Reticulum-Mitochondrial Phosphatidylserine Transfer Causes Liver Disease |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Pig, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PTDSS1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 91% |
| Peptide Sequence | Synthetic peptide located within the following region: MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTI |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-PTDSS1 (ARP47068_P050) antibody is Catalog # AAP47068 (Previous Catalog # AAPP27865) |
| Reference | Stone,S.J. (2000) J. Biol. Chem. 275 (44), 34534-34540 |
|---|---|
| Gene Symbol | PTDSS1 |
| Gene Full Name | Phosphatidylserine synthase 1 |
| Alias Symbols | LMHD, PSS1, PSSA |
| NCBI Gene Id | 9791 |
| Protein Name | Phosphatidylserine synthase 1 |
| Description of Target | PTDSS1 is a multi-pass membrane protein. It belongs to the phosphatidyl serine synthase family. PTDSS1 catalyzes a base-exchange reaction in which the polar head group of phosphatidylcholine is replaced by L-serine. |
| Uniprot ID | P48651 |
| Protein Accession # | NP_055569 |
| Nucleotide Accession # | NM_014754 |
| Protein Size (# AA) | 473 |
| Molecular Weight | 55kDa |
| Protein Interactions | UBC; STAU1; RNF2; ELAVL1; |
