Recombinant Bordetella pertussis Pertussis toxin subunit 1 (ptxA)
Cat# orb1881907-100ug
Size : 100ug
Brand : Biorbyt
Recombinant Bordetella pertussis Pertussis toxin subunit 1 (ptxA)
SKU: orb1881907
Description
Research Area
Infectious Disease & Virology
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) |
| Tag | N-terminal 6xHis-B2M-tagged |
| Expression Region | 35-269aa |
| Protein Length | Full Length of Mature Protein |
| MW | 40.8 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | DDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−(PTX S1)(Islet-activating protein S1)(IAP S1)(NAD-dependent ADP-ribosyltransferase)(EC 2.4.2.-)
−
Bordetella pertussis ptxA/PTXS1 Recombinant Protein (N-His) [orb2965040]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
27.16 kDa
1 mgRecombinant Bordetella bronchiseptica Pertussis toxin subunit 1 homolog (ptxA) [orb1882021]
Greater than 95% as determined by SDS-PAGE.
33.8 kDa
E.coli
1 mg, 100 μg, 20 μgRecombinant Bordetella parapertussis Pertussis toxin subunit 1 homolog (ptxA) [orb1882022]
Greater than 95% as determined by SDS-PAGE.
33.8 kDa
E.coli
1 mg, 100 μg, 20 μg
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide







