Recombinant horse Serum amyloid A protein
Cat# OPCA01299-100UG
Size : 100ug
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
SAA1 Recombinant Protein (Horse) (OPCA01299)
| Datasheets/Manuals | Printable datasheet for SAA1 Recombinant Protein (Horse) (OPCA01299) |
|---|
| Predicted Species Reactivity | Equus caballus|Horse |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Reconstitution and Storage | -20°C or -80°C |
| Peptide Sequence | LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFHARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRFSFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHGLPDKY |
| Source | Yeast |
| Protein Name | Serum amyloid A protein |
|---|---|
| Description of Target | Major acute phase reactant. Apolipoprotein of the HDL complex. |
| Uniprot ID | P19857 |
| Protein Size (# AA) | Full Length |
| Molecular Weight | 14.3 kDa |