Recombinant Human Cytokine receptor common subunit gamma(IL2RG)
Cat# orb2902566-100ug
Size : 100ug
Brand : Biorbyt
Recombinant Human Cytokine receptor common subunit gamma(IL2RG)
SKU: orb2902566
Description
Research Area
Immunology & Inflammation
Key Properties
−| Biological Origin | Homo sapiens (Human) |
|---|---|
| Expression Region | 23-369 |
| Protein Length | full length protein |
| Protein Sequence | LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET |
Storage & Handling
−| Storage | Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Cytokine receptor common subunit gamma, Interleukin-2 receptor subunit gamma, IL-2 receptor subunit gamma, IL-2R subunit gamma, IL-2RG, gammaC, p64, CD_antigen= CD132
−
Recombinant Human Cytokine receptor common subunit gamma (IL2RG) (N75Q), partial [orb1095924]
Greater than 85% as determined by SDS-PAGE.
25.0 kDa
Baculovirus
1 mg, 100 μg, 20 μgRecombinant Human IL-2RG Protein [orb3002329]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 55.4 KDa. Observed: 85-100 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide




