Reagents and instruments for immunology, cell biology and molecular biology.
 
> Recombinant Human DMC1 Protein, N-His

Recombinant Human DMC1 Protein, N-His

Print Print
Please log in

Cat# NB-21-31934

Size : 100µg

Brand : Neo Biotech

Contact local distributor :


Phone : +1 850 650 7790

Recombinant Human DMC1 Protein, N-His

Product name ARO-P11849-100
Uniprot ID Q14565
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE
Molecular weight 37.41 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Escherichia coli (E.coli)
Fragment Type Asp23-Glu340
Aliases /Synonyms Meiotic recombination protein DMC1/LIM15 homolog, LIM15, DMC1, DMC1H
Reference ARO-P11849
Note For research use only.
Molecular Constructor
Asp23–Glu340