| Product name | ARO-P16141-100 |
|---|---|
| Uniprot ID | P21754 |
| Origin species | Human |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | TFSLRLMEENWNAEKRSPTFHLGDAAHLQAEIHTGSHVPLRLFVDHCVATPTPDQNASPYHTIVDFHGCLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYITCHLKVTLAEQDPDELNKACSFSKPSNSWFPVEGSADICQCCNKGDCGTPSHSRRQPHVMSQWSRSASRNRRHVTEEADVTVG |
| Molecular weight | 23.78 kDa |
| Protein delivered with Tag? | N-Terminal His Tag |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Thr171-Gly363 |
| Aliases /Synonyms | Zona pellucida sperm-binding protein 3, Sperm receptor, ZP3A/ZP3B, Zona pellucida glycoprotein 3, Zp-3, Zona pellucida protein C, Processed zona pellucida sperm-binding protein 3, ZP3, ZP3A, ZP3B, ZPC |
| Reference | ARO-P16141 |
| Note | For research use only. |
| Molecular Constructor | His Thr171–Gly363 |