Recombinant Mouse Glucagon receptor
Cat# OPCA00095-1MG
Size : 1mg
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
GCGR Recombinant Protein (Mouse) (OPCA00095)
| Datasheets/Manuals | Printable datasheet for GCGR Recombinant Protein (Mouse) (OPCA00095) |
|---|
| Predicted Species Reactivity | Mouse|Mus musculus |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Additional Information | Tag information : GST tag |
| Reconstitution and Storage | -20°C or -80°C |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | AQVMDFLFEKWKLYSDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPPNTTANISCPWYLPWYHKVQHRLVFKRCGPDGQWVRGPRGQPWRNASQCQLDDEEIEVQKGVAKMYSSQQ |
| Protein Sequence | AQVMDFLFEKWKLYSDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPPNTTANISCPWYLPWYHKVQHRLVFKRCGPDGQWVRGPRGQPWRNASQCQLDDEEIEVQKGVAKMYSSQQ |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 27-143 aa |
| Tag | N-terminal GST-tagged |
| Reference | The glucagon receptor is required for the adaptive metabolic response to fasting.Longuet C., Sinclair E.M., Maida A., Baggio L.L., Maziarz M., Charron M.J., Drucker D.J.Cell Metab. 8:359-371(2008) |
|---|---|
| Gene Symbol | Gcgr |
| Gene Full Name | glucagon receptor |
| Alias Symbols | G, GL-R, glucagon receptor, GR. |
| NCBI Gene Id | 14527 |
| Protein Name | Glucagon receptor |
| Description of Target | G-protein coupled receptor for glucagon that plays a central role in the regulation of blood glucose levels and glucose homeostasis. Regulates the rate of hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis. Plays an important role in mediating the responses to fasting. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Promotes activation of adenylate cyclase. Besides, plays a role in signaling via a phosphatidylinositol-calcium second messenger system. |
| Uniprot ID | Q61606 |
| Protein Size (# AA) | Partial |
| Molecular Weight | 40.8 kda |