| Product name | PX-P5200-100 |
|---|---|
| Uniprot ID | Q02161 |
| Uniprot link | https://www.uniprot.org/uniprot/Q02161 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | SSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALG |
| Molecular weight | 36.51 kDa |
| Protein delivered with Tag? | N-GST Tag |
| Purity estimated | >90% as determined by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ser2-Gly87 |
| Protein Accession | Q02161 |
| Aliases /Synonyms | CD240D, RHXIII, Blood group Rh(D) polypeptide, Rh polypeptide 2, RhPII, Rhesus D antigen |
| Reference | PX-P5200 |
| Note | For research use only |
| Molecular Constructor | Ser2–Gly87 N-GST |