SLC7A11 Antibody - middle region - FITC
Cat# ARP43947_P050-FITC
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
SLC7A11 Antibody - middle region : FITC (ARP43947_P050-FITC)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-SLC7A11 (ARP43947_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SLC7A11 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 85%; Sheep: 92% |
| Peptide Sequence | Synthetic peptide located within the following region: KGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEK |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-SLC7A11 (ARP43947_P050-FITC) antibody is Catalog # AAP43947 (Previous Catalog # AAPP25482) |
| Gene Symbol | SLC7A11 |
|---|---|
| Gene Full Name | Solute carrier family 7 (anionic amino acid transporter light chain, xc- system), member 11 |
| Alias Symbols | xCT, CCBR1 |
| NCBI Gene Id | 23657 |
| Protein Name | Cystine/glutamate transporter |
| Description of Target | SLC7A11 is a member of a heteromeric Na(+)-independent anionic amino acid transport system highly specific for cystine and glutamate. In this system, designated system Xc(-), the anionic form of cystine is transported in exchange for glutamate. |
| Uniprot ID | Q9UPY5 |
| Protein Accession # | NP_055146 |
| Nucleotide Accession # | NM_014331 |
| Protein Size (# AA) | 501 |
| Molecular Weight | 55kDa |
| Protein Interactions | UBC; TERT; BAAT; SLC3A2; |
