SPO11 Protein, Human, Recombinant (His)

Print

Size : 10ug

Phone : +1 850 650 7790

Request more information

Phone : +1 850 650 7790

Remove All

(Synonyms: SPO11, Meiotic recombination protein SPO11, Cancer/testis antigen 35 (CT35)) Copy Product Info

Synonyms: SPO11, Meiotic recombination protein SPO11, Cancer/testis antigen 35 (CT35)

Catalog No. TMPH-04005 Copy Product Info

SPO11 Protein, Human, Recombinant (His) is expressed in Baculovirus Insect Cells with C-6xHis. The accession number is Q9Y5K1.

For research use only—not for human use. No sales to individuals. Use as intended only.

Product Introduction

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	SPO11 Protein, Human, Recombinant (His) is expressed in Baculovirus Insect Cells with C-6xHis. The accession number is Q9Y5K1.
Species	Human
Expression System	Baculovirus Insect Cells
Tag	C-6xHis
Accession Number	Q9Y5K1
Amino Acid	MAFAPMGPEASFFDVLDRHRESLLAALRRGGREPPTGGSRLASSSEVLASIENIIQDIITSLARNEAPAFTIDNRSSWENIKFEDSVGLQMVSHCTTRKIKSDSPKSAQKFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISCMLKVSRRSLHILSTSKGLIAGNLRYIEEDGTKVNCTCGATAVAVPSNIQGIRNLVTDAKFVLIVEKDATFQRLLDDNFCNKLSPCIMITGKGVPDLNTRLLVKKLWDTFHVPVFTLVDADPHGIEIMCIYKYGSMSMSFEAHHLTVPAIRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQPFWRKEMEIMADSKMKAEIQALTFLSSDYLSRVYLPNKLKFGGWI
Construction	1-396 aa
Protein Purity	>85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	SPO11, Meiotic recombination protein SPO11, Cancer/testis antigen 35 (CT35)

Chemical Properties

Molecular Weight	47.3 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

SPO 11CT35CT 35

Related Tags: SPO11 Protein, Human, Recombinant (His) chemical structure | SPO11 Protein, Human, Recombinant (His) molecular weight