Thyrotropin Releasing Hormone (TRH) (NM_007117) Human Mass Spec Standard

Cat# PH319231

Size : 10ug

Contact local distributor :


Phone :

Thyrotropin Releasing Hormone (TRH) (NM_007117) Human Mass Spec Standard

Be the first to review this product
SKU
PH319231
TRH MS Standard C13 and N15-labeled recombinant protein (NP_009048)
 
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219231
Predicted MW 27.4 kDa
Protein Sequence
Protein Sequence
>RC219231 protein sequence
Red=Cloning site Green=Tags(s)

MPGPWLLLALALTLNLTGVPGGRAQPEAAQQEAVTAAEHPGLDDFLRQVERLLFLRENIQRLQGDQGEHS
ASQIFQSDWLSKRQHPGKREEEEEEGVEEEEEEEGGAVGPHKRQHPGRREDEASWSVDVTQHKRQHPGRR
SPWLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDLMPEKRQHPGKRALGGPCGPQGAYGQAGLLL
GLLDDLSRSQGAEEKRQHPGRRAAWVREPLEE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009048
RefSeq Size 1890
RefSeq ORF 726
Synonyms Pro-TRH; TRF
Locus ID 7200
UniProt ID P20396
Cytogenetics 3q22.1
Summary This gene encodes a member of the thyrotropin-releasing hormone family. Cleavage of the encoded proprotein releases mature thyrotropin-releasing hormone, which is a tripeptide hypothalamic regulatory hormone. The human proprotein contains six thyrotropin-releasing hormone tripeptides. Thyrotropin-releasing hormone is involved in the regulation and release of thyroid-stimulating hormone, as well as prolactin. Deficiency of this hormone has been associated with hypothalamic hypothyroidism. provided by RefSeq, May 2013
Protein Families Druggable Genome, Secreted Protein
SKU Description Size
LC416185 Lyophilized TRH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY416185 Transient overexpression lysate of thyrotropin-releasing hormone (TRH) (as WB positive control) 100 ug
TP319231 Recombinant protein of human thyrotropin-releasing hormone (TRH), 20 µg 20 ug

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products