ARP40916_P050-FITC | TMEM63B Antibody - middle region

TMEM63B Antibody - middle region : FITC (ARP40916_P050-FITC)

Datasheets/Manuals	Printable datasheet for anti-TMEM63B (ARP40916_P050-FITC) antibody

Product Info
Predicted Species Reactivity	Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
Product Format	Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality	Polyclonal
Host	Rabbit
Conjugation	FITC: Fluorescein Isothiocyanate
Application	WB
Reconstitution and Storage	All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human TMEM63B
Purification	Affinity Purified
Predicted Homology Based on Immunogen Sequence	Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Peptide Sequence	Synthetic peptide located within the following region: VRGCEQVEAIEYYTKLEQKLKEDYKREKEKVNEKPLGMAFVTFHNETITA
Concentration	0.5 mg/ml
Blocking Peptide	For anti-TMEM63B (ARP40916_P050-FITC) antibody is Catalog # AAP40916 (Previous Catalog # AAPP22886)

Reference	Mungall,A.J., (2003) Nature 425 (6960), 805-811
Gene Symbol	TMEM63B
Gene Full Name	Transmembrane protein 63B
Alias Symbols	C6orf110
NCBI Gene Id	55362
Protein Name	Transmembrane protein 63B
Description of Target	TMEM63B belongs to the SPO75/TMEM63 family. It is a multi-pass membrane protein. The function of TMEM63B remains unknown.
Uniprot ID	Q5T3F8
Protein Accession #	NP_060896
Nucleotide Accession #	NM_018426
Protein Size (# AA)	832
Molecular Weight	95kDa
Protein Interactions	UBC; MAPK14; ELAVL1; Tmem63b;