TNF, Recombinant, Sheep, aa78-234, His-Tag (Tumor Necrosis Factor)
Cat# 375618-100ug
Size : 100ug
Brand : US Biological
375618 TNF, Recombinant, Sheep, aa78-234, His-Tag (Tumor Necrosis Factor)
Swiss Prot
P23383Grade
PurifiedShipping Temp
Blue IceStorage Temp
-20°CCytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.
Source:
Recombinant protein corresponding to aa78-234 from sheep Tumor Necrosis Factor, fused to His-Tag at N-terminal, expressed in Yeast.
Molecular Weight:
~19.2kD
Amino Acid Sequence:
LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL
Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

