TNMD antibody - N-terminal region
Cat# ARP49696_P050
Size : 100ul
Brand : Aviva Systems Biology
TNMD Antibody - N-terminal region (ARP49696_P050)
| Datasheets/Manuals | Printable datasheet for anti-TNMD (ARP49696_P050) antibody |
|---|
| Tested Species Reactivity | Human, Mouse |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TNMD |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 85% |
| Peptide Sequence | Synthetic peptide located within the following region: KKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIK |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-TNMD (ARP49696_P050) antibody is Catalog # AAP49696 (Previous Catalog # AAPP29277) |
| Enhanced Validation |
| Reference | Tolppanen,A.M., (2007) Obesity (Silver Spring) 15 (5), 1082-1088 |
|---|---|
| Gene Symbol | TNMD |
| Gene Full Name | Tenomodulin |
| Alias Symbols | TEM, CHM1L, BRICD4 |
| NCBI Gene Id | 64102 |
| Protein Name | Tenomodulin |
| Description of Target | TNMD is a single-pass type II membrane proteinPotential. It belongs to the chondromodulin-1 family and contains 1 BRICHOS domain. TNMD may be an angiogenesis inhibitor. |
| Uniprot ID | Q9H2S6 |
| Protein Accession # | NP_071427 |
| Nucleotide Accession # | NM_022144 |
| Protein Size (# AA) | 317 |
| Molecular Weight | 37 kDa |
| Protein Interactions | TMEM79; |






