Transthyretin Protein, Mouse, Recombinant
Cat# NB-64-51616-500ug
Size : 500ug
Brand : Neo Biotech
Remove All
Transthyretin Protein, Mouse, Recombinant
(Synonyms: Ttr, Transthyretin, Prealbumin) Copy Product InfoSynonyms: Ttr, Transthyretin, Prealbumin
Catalog No. TMPH-02947 Copy Product Info
Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain. Transthyretin Protein, Mouse, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 13.5 kDa and the accession number is P07309.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain. Transthyretin Protein, Mouse, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 13.5 kDa and the accession number is P07309. |
| Species | Mouse |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | P07309 |
| Amino Acid | AGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN |
| Construction | 23-147 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | Ttr, Transthyretin, Prealbumin |
| Research Background | Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain. |
| Molecular Weight | 13.5 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Related Tags: Transthyretin Protein, Mouse, Recombinant chemical structure | Transthyretin Protein, Mouse, Recombinant molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

