TRIM65 Protein, Human, Recombinant (His)

Print

Size : 5ug

Phone : +1 850 650 7790

Request more information

Phone : +1 850 650 7790

(Synonyms: Tripartite motif-containing protein 65, TRIM65, E3 ubiquitin-protein ligase TRIM65) Copy Product Info

TRIM65 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q6PJ69.

For research use only—not for human use. No sales to individuals. Use as intended only.

Batch Information

Select Batch

Purity:88%

Appearance:Lyophilized powder

Color:Transparent

COAUser Guide of Recombinant Proteins

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it.
Description	TRIM65 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q6PJ69.
Species	Human
Expression System	Yeast
Tag	C-6xHis
Accession Number	P43003
Amino Acid	HPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPG
Construction	146-236 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Tripartite motif-containing protein 65, TRIM65, E3 ubiquitin-protein ligase TRIM65

Chemical Properties

Molecular Weight	64.1 kDa (Predicted); 66 kDa (Reducing conditions)
Relative Density.	no data available

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.