Vaccinia virus OPG190 Protein (His)

Print

Size : 5ug

Phone : +1 850 650 7790

Request more information

Phone : +1 850 650 7790

(Synonyms: Protein OPG190, Plaque-size/host range protein, B5R) Copy Product Info

Vaccinia virus OPG190 Protein (His) is expressed in in vitro E. coli expression system. The accession number is Q80KX4.

For research use only—not for human use. No sales to individuals. Use as intended only.

Resource Download

User Guide of Recombinant Proteins

Bioactivity

Bioactivity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Vaccinia virus OPG190 Protein (His) is expressed in in vitro E. coli expression system. The accession number is Q80KX4.
Species	Vaccinia virus
Expression System	in vitro E. coli expression system
Tag	N-10xHis
Accession Number	Q80KX4
Amino Acid	MKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYITINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPILPTCVRSNKEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYHIIIVALTIMGVIFLISVIVLVCSCDKNNDQYKFHKLLP
Construction	1-317 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Endotoxin	Not tested.
Formulation	Lyophilized from PBS, 0.05% Brij-78, 6% Trehalose, pH 7.4
Reconstitution	Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Synonyms	Protein OPG190, Plaque-size/host range protein, B5R

Chemical Properties

Molecular Weight

41.2 kDa (Predicted)

Storage & Solubility Information

Shipping	In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 9 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.