Anti-Human FGF2/bFGF Antibody (SAA0437), APC

Référence NB-21-44987

Conditionnement : 100µg

Marque : Neo Biotech

Contactez votre distributeur local :


Téléphone : +1 850 650 7790

Clonality:
Monoclonal Antibody
Host species:
Mouse
Isotype:
IgG1, kappa
Target species:
Human
Clone Name:
SAA0437

Specifications Anti-Human FGF2/bFGF Antibody (SAA0437), APC

Product name ARO-A10252-100
Uniprot ID P09038
Raw Antigen Sequence MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-bFGF, FGF2, Basic fibroblast growth factor, HBGF-2, FGFB, FGF-2, Heparin-binding growth factor 2, Fibroblast growth factor 2
Reference ARO-A10252
Note For research use only.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Target bFGF, FGF2, Basic fibroblast growth factor, HBGF-2, FGFB, FGF-2, Heparin-binding growth factor 2, Fibroblast growth factor 2
Clone Name SAA0437
Target species Human
Product name ARO-A10252-1MG
Uniprot ID P09038
Raw Antigen Sequence MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-bFGF, FGF2, Basic fibroblast growth factor, HBGF-2, FGFB, FGF-2, Heparin-binding growth factor 2, Fibroblast growth factor 2
Reference ARO-A10252
Note For research use only.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Target bFGF, FGF2, Basic fibroblast growth factor, HBGF-2, FGFB, FGF-2, Heparin-binding growth factor 2, Fibroblast growth factor 2
Clone Name SAA0437
Target species Human
Product name ARO-A10252-50
Uniprot ID P09038
Raw Antigen Sequence MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Buffer 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-bFGF, FGF2, Basic fibroblast growth factor, HBGF-2, FGFB, FGF-2, Heparin-binding growth factor 2, Fibroblast growth factor 2
Reference ARO-A10252
Note For research use only.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Target bFGF, FGF2, Basic fibroblast growth factor, HBGF-2, FGFB, FGF-2, Heparin-binding growth factor 2, Fibroblast growth factor 2
Clone Name SAA0437
Target species Human

Documents

Reviews

There are no reviews yet.

Be the first to review “Anti-Human FGF2/bFGF Antibody (SAA0437), APC” Cancel reply

Related products

  • Anti-FGF2 Polyclonal antibody binds to Human FGF2/bFGF Recombinant Protein, N-His-SUMO in WB Assay

    ARO-A14173

    Anti-FGF2 Polyclonal antibody