Anti-Human FGF2/bFGF Antibody (SAA0437), APC

Specifications Anti-Human FGF2/bFGF Antibody (SAA0437), APC

Product name	ARO-A10252-100
Uniprot ID	P09038
Raw Antigen Sequence	MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Buffer	0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Mouse
Aliases /Synonyms	Anti-bFGF, FGF2, Basic fibroblast growth factor, HBGF-2, FGFB, FGF-2, Heparin-binding growth factor 2, Fibroblast growth factor 2
Reference	ARO-A10252
Note	For research use only.
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody
Target	bFGF, FGF2, Basic fibroblast growth factor, HBGF-2, FGFB, FGF-2, Heparin-binding growth factor 2, Fibroblast growth factor 2
Clone Name	SAA0437
Target species	Human

Product name	ARO-A10252-1MG
Uniprot ID	P09038
Raw Antigen Sequence	MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Buffer	0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Mouse
Aliases /Synonyms	Anti-bFGF, FGF2, Basic fibroblast growth factor, HBGF-2, FGFB, FGF-2, Heparin-binding growth factor 2, Fibroblast growth factor 2
Reference	ARO-A10252
Note	For research use only.
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody
Target	bFGF, FGF2, Basic fibroblast growth factor, HBGF-2, FGFB, FGF-2, Heparin-binding growth factor 2, Fibroblast growth factor 2
Clone Name	SAA0437
Target species	Human

Product name	ARO-A10252-50
Uniprot ID	P09038
Raw Antigen Sequence	MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Buffer	0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Mouse
Aliases /Synonyms	Anti-bFGF, FGF2, Basic fibroblast growth factor, HBGF-2, FGFB, FGF-2, Heparin-binding growth factor 2, Fibroblast growth factor 2
Reference	ARO-A10252
Note	For research use only.
Isotype	IgG1, kappa
Clonality	Monoclonal Antibody
Target	bFGF, FGF2, Basic fibroblast growth factor, HBGF-2, FGFB, FGF-2, Heparin-binding growth factor 2, Fibroblast growth factor 2
Clone Name	SAA0437
Target species	Human

Documents

• Datasheet

Reviews

There are no reviews yet.

Be the first to review “Anti-Human FGF2/bFGF Antibody (SAA0437), APC” Cancel reply