Conditionnement : 100µg
| Product name | ARO-P13541-100 |
|---|---|
| Uniprot ID | P84022 |
| Origin species | Human |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | DLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS |
| Molecular weight | 25.52 kDa |
| Protein delivered with Tag? | N-Terminal His Tag |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Asp220-Ser425 |
| Aliases /Synonyms | Mad3, JV15-2, Mothers against decapentaplegic homolog 3, SMAD family member 3, Smad3, SMAD3, MADH3, hMAD-3, SMAD 3, MAD homolog 3, hSMAD3, Mothers against DPP homolog 3 |
| Reference | ARO-P13541 |
| Note | For research use only. |
| Molecular Constructor | His Asp220–Ser425 |