Recombinant Human SMAD3, N-His

Cat# NB-21-29526

Size : 100µg

Brand : Neo Biotech

Contact local distributor :


Phone : +1 850 650 7790

Recombinant Human SMAD3, N-His

Product name ARO-P13541-100
Uniprot ID P84022
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
Molecular weight 25.52 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Escherichia coli (E.coli)
Fragment Type Asp220-Ser425
Aliases /Synonyms Mad3, JV15-2, Mothers against decapentaplegic homolog 3, SMAD family member 3, Smad3, SMAD3, MADH3, hMAD-3, SMAD 3, MAD homolog 3, hSMAD3, Mothers against DPP homolog 3
Reference ARO-P13541
Note For research use only.
Molecular Constructor
His Asp220–Ser425