- Specifications
Product Description
Human DAF full-length ORF ( NP_000565.1, 1 a.a. - 381 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MTVARPSVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSGTTRLLSGHTCFTLTGLLGTLVTMGLLT
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
67.8
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
- Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
- Gene Info — CD55
Entrez GeneID
1604GeneBank Accession#
NM_000574.2Protein Accession#
NP_000565.1Gene Name
CD55
Gene Alias
CR, CROM, DAF, TC
Gene Description
CD55 molecule, decay accelerating factor for complement (Cromer blood group)
Omim ID
125240Gene Ontology
HyperlinkGene Summary
This gene encodes a protein involved in the regulation of the complement cascade. The encoded glycoprotein is also known as the decay-accelerating factor (DAF); binding of DAF to complement proteins accelerates their decay, disrupting the cascade and preventing damage to host cells. Antigens present on the DAF glycoprotein constitute the Cromer blood group system (CROM). Two alternatively spliced transcripts encoding different proteins have been identified. The predominant transcript encodes a membrane-bound protein expressed on cells exposed to plasma component proteins but an alternatively spliced transcript produces a soluble protein present at much lower levels. Additional, alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq
Other Designations
CD55 antigen|decay accelerating factor for complement
- Interactomes
- Pathways
- Diseases
- Publication Reference
- Single-Molecule Bioelectronic Portable Array for Early-Diagnosis of Pancreatic Cancer Precursors.
Enrico Genco, Francesco Modena, Lucia Sarcina, Kim Björkström, Celestino Brunetti, Mario Caironi, Mariapia Caputo, Virginia Maria Demartis, Cinzia Di Franco, Giulia Frusconi, Lena Haeberle, Piero Larizza, Maria Teresa Mancini, Ronald Österbacka, William Reeves, Gaetano Scamarcio, Cecilia Scandurra, May Wheeler, Eugenio Cantatore, Irene Esposito, Eleonora Macchia, Fabrizio Torricelli, Fabrizio Antonio Viola, Luisa Torsi.
Advanced Materials 2023 Jul; e2304102.
Application:chem-SAM, N/A, Recombinant proteins.
- Single-Molecule Bioelectronic Portable Array for Early-Diagnosis of Pancreatic Cancer Precursors.
DAF (Human) Recombinant Protein (P01)
Cat# H00001604-P01-25ug
Size : 25ug
Brand : Abnova
Images