- Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant DAF.
Immunogen
DAF (NP_000565, 35 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLRGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYR
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Immunofluorescence
Immunofluorescence of monoclonal antibody to CD55 on HeLa cell . [antibody concentration 10 ug/ml]ELISA
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CD55 is 0.1 ng/ml as a capture antibody.Western Blot (Transfected lysate)
Western Blot analysis of CD55 expression in transfected 293T cell line by DAF monoclonal antibody (M02), clone 1D7.
Lane 1: CD55 transfected lysate(41.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
- Gene Info — CD55
Entrez GeneID
1604GeneBank Accession#
NM_000574Protein Accession#
NP_000565Gene Name
CD55
Gene Alias
CR, CROM, DAF, TC
Gene Description
CD55 molecule, decay accelerating factor for complement (Cromer blood group)
Omim ID
125240Gene Ontology
HyperlinkGene Summary
This gene encodes a protein involved in the regulation of the complement cascade. The encoded glycoprotein is also known as the decay-accelerating factor (DAF); binding of DAF to complement proteins accelerates their decay, disrupting the cascade and preventing damage to host cells. Antigens present on the DAF glycoprotein constitute the Cromer blood group system (CROM). Two alternatively spliced transcripts encoding different proteins have been identified. The predominant transcript encodes a membrane-bound protein expressed on cells exposed to plasma component proteins but an alternatively spliced transcript produces a soluble protein present at much lower levels. Additional, alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq
Other Designations
CD55 antigen|decay accelerating factor for complement
- Interactomes
- Pathways
- Diseases
DAF monoclonal antibody (M02), clone 1D7
Cat# H00001604-M02
Size : 100ug
Brand : Abnova
Images





