EIF1AX Antibody - middle region - FITC
Cat# ARP46055_P050-FITC
Size : 100ul
Brand : Aviva Systems Biology
EIF1AX Antibody - middle region : FITC (ARP46055_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-EIF1AX (ARP46055_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human EIF1AX |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 92%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: KYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDD |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-EIF1AX (ARP46055_P050-FITC) antibody is Catalog # AAP46055 (Previous Catalog # AAPP26896) |
| Reference | Kim,S., (2007) Stem Cells Dev. 16 (4), 537-545 |
|---|---|
| Gene Symbol | EIF1AX |
| Gene Full Name | Eukaryotic translation initiation factor 1A, X-linked |
| Alias Symbols | EIF1A, EIF4C, eIF-1A, eIF-4C, EIF1AP1 |
| NCBI Gene Id | 1964 |
| Protein Name | Eukaryotic translation initiation factor 1A, X-chromosomal |
| Description of Target | This gene encodes an essential eukaryotic translation initiation factor. The protein is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA. |
| Uniprot ID | P47813 |
| Protein Accession # | NP_001403 |
| Nucleotide Accession # | NM_001412 |
| Protein Size (# AA) | 144 |
| Molecular Weight | 16kDa |
| Protein Interactions | UBC; ADSL; FLII; APP; ELAVL1; DCC; IKBKG; IPO13; EIF5B; EIF3C; EIF2S1; EIF5; |



