Recombinant HMPV SH/Small hydrophobic Protein, N-His

Cat# NB-21-32948

Size : 100µg

Brand : Neo Biotech

Contact local distributor :


Phone : +1 850 650 7790

Recombinant HMPV SH/Small hydrophobic Protein, N-His

Product name ARO-P15729-100
Uniprot ID Q6WB95
Origin species Human metapneumovirus (strain CAN97-83) (HMPV
Expression system Prokaryotic expression
Raw Antigen Sequence NYIKVENNLQICQSKTESDKEDSPSNTTSVTTKTTLDHDITQYFKRLIQRYTDSVINKDTCWKISRNQCTNITTYKFLCFKPEDSKINSCDRLTDLCRNKSKSAAEAYHTVECHCIYTIEWKCYHHSID
Molecular weight 17.44 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Host species Escherichia coli (E.coli)
Fragment Type Asn51-Asp179
Aliases /Synonyms Small hydrophobic protein, SH
Reference ARO-P15729
Note For research use only.
Molecular Constructor
His Asn51–Asp179