Images
QC Test

  • Specifications

    Product Description

    Human TNFSF14 full-length ORF ( NP_742011.1, 1 a.a. - 204 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength,small size,trial size

    Sequence

    MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEEVVVRVLDERLVRLRDGTRSYFGAFMV

    Host

    Wheat Germ (in vitro)

    Theoretical MW (kDa)

    48.8

    Interspecies Antigen Sequence

    Mouse (66); Rat (68)

    Preparation Method

    in vitro wheat germ expression system

    Purification

    Glutathione Sepharose 4 Fast Flow

    Quality Control Testing

    12.5% SDS-PAGE Stained with Coomassie Blue.

    Storage Buffer

    50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

    Storage Instruction

    Store at -80°C. Aliquot to avoid repeated freezing and thawing.

    Note

    Best use within three months from the date of receipt of this protein.

  • Applications

    Enzyme-linked Immunoabsorbent Assay

    Western Blot (Recombinant protein)

    Antibody Production

    Protein Array

  • Gene Info — TNFSF14

    Entrez GeneID

    8740

    GeneBank Accession#

    NM_172014.1

    Protein Accession#

    NP_742011.1

    Gene Name

    TNFSF14

    Gene Alias

    CD258, HVEML, LIGHT, LTg, TR2

    Gene Description

    tumor necrosis factor (ligand) superfamily, member 14

    Omim ID

    604520

    Gene Ontology

    Hyperlink

    Gene Summary

    The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry mediator (HVEM). This protein may function as a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. This protein has been shown to stimulate the proliferation of T cells, and trigger apoptosis of various tumor cells. This protein is also reported to prevent tumor necrosis factor alpha mediated apoptosis in primary hepatocyte. Two alternatively spliced transcript variant encoding distinct isoforms have been reported. [provided by RefSeq

    Other Designations

    delta transmembrane LIGHT|herpesvirus entry mediator A|ligand for herpesvirus entry mediator|tumor necrosis factor ligand superfamily, member 14|tumor necrosis factor receptor-like 2|tumor necrosis factor superfamily member LIGHT

  • Interactomes
  • Pathways
  • Diseases